PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 306aa    MW: 32742.6 Da    PI: 9.7253
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014327genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.47.8e-6471491147
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqssl 98 
                  g+sgr p+wkErEnn rRERrRRaiaakiy+GLR+qGn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kpl   e+ag+  s s  ss+q s+
  Lus10014327   7 GSSGRLPSWKERENNMRRERRRRAIAAKIYTGLRSQGNFKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKPL-PGEIAGTPLSFSGGSSIQPSP 103
                  689*************************************************************************.********************* PP

       DUF822  99 kssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvs 147
                  +ss+++spv sy+asp+sssfpsps+++ +++a    llp+l++ ++++
  Lus10014327 104 QSSNFQSPVISYQASPTSSSFPSPSRFEANPSA---YLLPLLRNIASIP 149
                  ****************************99885...8888888887755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.2E-608132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAGGGGGSSG RLPSWKEREN NMRRERRRRA IAAKIYTGLR SQGNFKLPKH CDNNEVLKAL  60
CAEAGWIVEE DGTTYRKGCK PLPGEIAGTP LSFSGGSSIQ PSPQSSNFQS PVISYQASPT  120
SSSFPSPSRF EANPSAYLLP LLRNIASIPT NLPPLRISNS APVTPPLSSP TRNSNASLAN  180
NATIVNSFNH PIFAASAPSS PTRRHHYFQP IPECDESDGS IIDSGRWLSF QGVPSSQTIP  240
VSPTFNLVRP VVGANVNAAA SGVDNVRSSE FEFGNRKVKP WEGERIHEMG TDDLELTLAS  300
GKARG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383240.11e-122hypothetical protein POPTR_0005s12790g
SwissprotQ8S3071e-104BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLB9MXS01e-122B9MXS0_POPTR; Uncharacterized protein
STRINGPOPTR_0005s12790.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-98BES1 family protein